MRPL30 (NM_145213) Human Recombinant Protein
CAT#: TP320428
Recombinant protein of human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg
View other "MRPL30" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220428 protein sequence
Red=Cloning site Green=Tags(s) MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVT RIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLK STGELVVQWHLKPVEQKAHES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660214 |
Locus ID | 51263 |
UniProt ID | Q8TCC3 |
Refseq Size | 1172 |
Cytogenetics | 2q11.2 |
Refseq ORF | 483 |
Synonyms | FLJ44438; MGC3314; MGC24095; mitochondrial ribosomal protein L30; MRP-L28; MRPL28; OTTHUMP00000161222; RPML28 |
Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene. [provided by RefSeq, Mar 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403434 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407915 | MRPL30 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403434 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY407915 | Transient overexpression lysate of mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
PH320428 | MRPL30 MS Standard C13 and N15-labeled recombinant protein (NP_660214) |
CNY 19,520.00 |