LIM kinase 2 (LIMK2) (NM_016733) Human Recombinant Protein
CAT#: TP320400
Recombinant protein of human LIM domain kinase 2 (LIMK2), transcript variant 2b, 20 µg
View other "LIM kinase 2" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220400 representing NM_016733
Red=Cloning site Green=Tags(s) MGSYLSVPAYFTSRDLFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEFCHGCSLLMTGPFMVAGEFKY HPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQEQLPYSVTLISMPATTEG RRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAISQTSQTL QLLIEHDPVSQRLDQLRLEARLAPHMQNAGHPHALSTLDTKENLEGTLRRRSLRRSNSISKSPGPSSPKE PLLFSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQK TFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAY LHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPY WMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAA ICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRDSPP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 69.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057952 |
Locus ID | 3985 |
UniProt ID | P53671 |
Refseq Size | 3848 |
Cytogenetics | 22q12.2 |
Refseq ORF | 1851 |
Summary | There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413829 | LIMK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422193 | LIMK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413829 | Transient overexpression lysate of LIM domain kinase 2 (LIMK2), transcript variant 2b |
CNY 4,840.00 |
|
LY422193 | Transient overexpression lysate of LIM domain kinase 2 (LIMK2), transcript variant 1 |
CNY 3,080.00 |
|
PH320400 | LIMK2 MS Standard C13 and N15-labeled recombinant protein (NP_057952) |
CNY 19,520.00 |
|
TP761350 | Purified recombinant protein of Human LIM domain kinase 2 (LIMK2), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它LIM kinase 2产品