Paralemmin (PALM) (NM_001040134) Human Recombinant Protein
CAT#: TP320338
Purified recombinant protein of Homo sapiens paralemmin (PALM), transcript variant 2, 20 µg
View other "Paralemmin" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220338 representing NM_001040134
Red=Cloning site Green=Tags(s) MEVLAAETTSQQERLQAIAEKRKRQAEIENKRRQLEDERRQLQHLKSKALRERWLLEGTPSSASEGDEDL RRQMQDDEQKTRLLEDSVSRLEKEIEVLERGDSAPATAKENAAAPSPVRAPAPSPAKEERKTEVVMNSQQ TPVGTPKDKRVSNTPLRTVDGSPMMKAVVHAVDGTAENGIHPLSSSEVDELIHKADEVTLSEAGSTAGAA ETRGAVEGAARTTPSRREITGVQAQPGEATSGPPGIQPGQEPPVTMIFMGYQNVEDEAETKKVLGLQDTI TAELVVIEDAAEPKEPAPPNGSAAEPPTEAASREENQAGPEATTSDPQDLDMKKHRCKCCSIM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035224 |
Locus ID | 5064 |
UniProt ID | O75781, A0A024R207 |
Refseq Size | 2758 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1029 |
Synonyms | PALM1 |
Summary | This gene encodes a member of the paralemmin protein family. The product of this gene is a prenylated and palmitoylated phosphoprotein that associates with the cytoplasmic face of plasma membranes and is implicated in plasma membrane dynamics in neurons and other cell types. Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419238 | PALM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419238 | Transient overexpression lysate of paralemmin (PALM), transcript variant 1 |
CNY 3,080.00 |
|
PH320338 | PALM MS Standard C13 and N15-labeled recombinant protein (NP_001035224) |
CNY 14,250.00 |
其它Paralemmin产品