Retinal S antigen (SAG) (NM_000541) Human Recombinant Protein
CAT#: TP320057
Recombinant protein of human S-antigen; retina and pineal gland (arrestin) (SAG), 20 µg
View other "Retinal S antigen" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220057 representing NM_000541
Red=Cloning site Green=Tags(s) MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFR YGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAP QDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLA VSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTK TLTLLPLLTNNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSE VATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.9 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000532 |
Locus ID | 6295 |
UniProt ID | P10523 |
Refseq Size | 1564 |
Cytogenetics | 2q37.1 |
Refseq ORF | 1215 |
Synonyms | RP47; S-AG |
Summary | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. S-arrestin, also known as S-antigen, is a major soluble photoreceptor protein that is involved in desensitization of the photoactivated transduction cascade. It is expressed in the retina and the pineal gland and inhibits coupling of rhodopsin to transducin in vitro. Additionally, S-arrestin is highly antigenic, and is capable of inducing experimental autoimmune uveoretinitis. Mutations in this gene have been associated with Oguchi disease, a rare autosomal recessive form of night blindness. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Antigen-specificity of antiretinal antibodies in patients with noninfectious uveitis
,Gibbs, E;Matsubara, J;Cao, S;Cui, J;Forooghian, F;,
Canadian Journal of Ophthalmology / Journal Canadien d'Ophtalmologie
[SAG]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424652 | SAG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424652 | Transient overexpression lysate of S-antigen; retina and pineal gland (arrestin) (SAG) |
CNY 3,080.00 |
|
PH320057 | SAG MS Standard C13 and N15-labeled recombinant protein (NP_000532) |
CNY 19,520.00 |
其它Retinal S antigen产品