VPS24 (CHMP3) (NM_016079) Human Recombinant Protein
CAT#: TP320006
Recombinant protein of human vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1, 20 µg
View other "VPS24" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220006 protein sequence
Red=Cloning site Green=Tags(s) MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL EAMQSRLATLRS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057163 |
Locus ID | 51652 |
UniProt ID | Q9Y3E7 |
Refseq Size | 3194 |
Cytogenetics | 2p11.2 |
Refseq ORF | 666 |
Synonyms | CGI-149; NEDF; VPS24 |
Summary | This gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene. [provided by RefSeq, Nov 2010] |
Protein Pathways | Endocytosis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414204 | CHMP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414204 | Transient overexpression lysate of vacuolar protein sorting 24 homolog (S. cerevisiae) (VPS24), transcript variant 1 |
CNY 3,080.00 |
|
PH320006 | VPS24 MS Standard C13 and N15-labeled recombinant protein (NP_057163) |
CNY 19,520.00 |