MZT2A (NM_001085365) Human Recombinant Protein
CAT#: TP319963
Recombinant protein of human family with sequence similarity 128, member A (FAM128A), 20 µg
View other "MZT2A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219963 representing NM_001085365
Red=Cloning site Green=Tags(s) MELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRG RDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001078834 |
Locus ID | 653784 |
UniProt ID | Q6P582 |
Refseq Size | 708 |
Cytogenetics | 2q21.1 |
Refseq ORF | 363 |
Synonyms | FAM128A; MOZART2A |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421274 | MZT2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421274 | Transient overexpression lysate of family with sequence similarity 128, member A (FAM128A) |
CNY 3,080.00 |
|
PH319963 | FAM128A MS Standard C13 and N15-labeled recombinant protein (NP_001078834) |
CNY 14,250.00 |
|
TP710150 | Purified protein of Homo sapiens mitotic spindle organizing protein 2A (MZT2A), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |