SAP155 (SF3B1) (NM_001005526) Human Recombinant Protein
CAT#: TP319649
Recombinant protein of human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, 20 µg
View other "SAP155" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219649 representing NM_001005526
Red=Cloning site Green=Tags(s) MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGF YSAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001005526 |
Locus ID | 23451 |
UniProt ID | B4DGZ4 |
Refseq Size | 647 |
Cytogenetics | 2q33.1 |
Refseq ORF | 432 |
Synonyms | Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155 |
Summary | This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423624 | SF3B1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423624 | Transient overexpression lysate of splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2 |
CNY 3,080.00 |
|
PH319649 | SF3B1 MS Standard C13 and N15-labeled recombinant protein (NP_001005526) |
CNY 19,520.00 |