COX8C (NM_182971) Human Recombinant Protein
CAT#: TP319625
Recombinant protein of human cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein, 20 µg
View other "COX8C" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219625 protein sequence
Red=Cloning site Green=Tags(s) MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFR RN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_892016 |
Locus ID | 341947 |
UniProt ID | Q7Z4L0 |
Refseq Size | 531 |
Cytogenetics | 14q32.12 |
Refseq ORF | 216 |
Synonyms | COX8-3 |
Summary | This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405286 | COX8C HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405286 | Transient overexpression lysate of cytochrome c oxidase subunit 8C (COX8C), nuclear gene encoding mitochondrial protein |
CNY 3,080.00 |
|
PH319625 | COX8C MS Standard C13 and N15-labeled recombinant protein (NP_892016) |
CNY 19,520.00 |