HVCN1 (NM_032369) Human Recombinant Protein
CAT#: TP319422
Recombinant protein of human hydrogen voltage-gated channel 1 (HVCN1), transcript variant 2, 20 µg
View other "HVCN1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219422 protein sequence
Red=Cloning site Green=Tags(s) MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_115745 |
Locus ID | 84329 |
UniProt ID | Q96D96 |
Refseq Size | 1727 |
Cytogenetics | 12q24.11 |
Refseq ORF | 819 |
Synonyms | HV1; VSOP |
Summary | This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410163 | HVCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421678 | HVCN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410163 | Transient overexpression lysate of hydrogen voltage-gated channel 1 (HVCN1), transcript variant 2 |
CNY 3,080.00 |
|
LY421678 | Transient overexpression lysate of hydrogen voltage-gated channel 1 (HVCN1), transcript variant 1 |
CNY 3,080.00 |
|
PH319422 | HVCN1 MS Standard C13 and N15-labeled recombinant protein (NP_115745) |
CNY 19,520.00 |