KTEL1 (POGLUT1) (NM_020231) Human Recombinant Protein
CAT#: TP319177
Recombinant protein of human KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1), 20 µg
View other "KTEL1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219177 representing NM_020231
Red=Cloning site Green=Tags(s) MEWWASSPLRLWLLLFLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRG GISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFILEVIGRLPDMEMVINVRDYPQVPKW MEPAIPVFSFSKTSEYHDIMYPAWTFWEGGPAVWPIYPTGLGRWDLFREDLVRSAAQWPWKKKNSTAYFR GSRTSPERDPLILLSRKNPKLVDAEYTKNQAWKSMKDTLGKPAAKDVHLVDHCKYKYLFNFRGVAASFRF KHLFLCGSLVFHVGDEWLEFFYPQLKPWVHYIPVKTDLSNVQELLQFVKANDDVAQEIAERGSQFIRNHL QMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064616 |
Locus ID | 56983 |
UniProt ID | Q8NBL1 |
Refseq Size | 1973 |
Cytogenetics | 3q13.33 |
Refseq ORF | 1176 |
Synonyms | CLP46, MDSRP, C3orf9, MDS010, hCLP46, KDELCL1, MGC32995 |
Summary | This gene encodes a protein with both O-glucosyltransferase and O-xylosyltransferase activity which localizes to the lumen of the endoplasmic reticulum. This protein has a carboxy-terminal KTEL motif which is predicted to function as an endoplasmic reticulum retention signal. This gene is an essential regulator of Notch signalling and likely plays a role in cell fate and tissue formation during development. It may also play a role in the pathogenesis of leukemia. Mutations in this gene have been associated with the autosomal dominant genodermatosis Dowling-Degos disease 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402765 | KTELC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402765 | Transient overexpression lysate of KTEL (Lys-Tyr-Glu-Leu) containing 1 (KTELC1) |
CNY 3,080.00 |
|
PH319177 | KTELC1 MS Standard C13 and N15-labeled recombinant protein (NP_064616) |
CNY 19,520.00 |