United States
Germany
Japan
United Kingdom
China
SEPTIN6 (NM_145800) Human Recombinant Protein
CAT＃: TP318686
Recombinant protein of human septin 6 (SEPT6), transcript variant III, 20 µg
View other "SEPTIN6" proteins (15)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218686 representing NM_145800
Red=Cloning site Green=Tags(s) MAATDIARQVGEGCRTVPLAGHVGFDSLPDQLVNKSVSQGFCFNILCVGETGLGKSTLMDTLFNTKFEGE PATHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGDQINKEDSYKPIVEFIDAQFEAYLQEELKIRRVL HTYHDSRIHVCLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADAISKSELTKFKIKITSELVSNGV QIYQFPTDDESVAEINGTMNAHLPFAVIGSTEELKIGNKMMRARQYPWGTVQVENEAHCDFVKLREMLIR VNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV KEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDEVNAFKQRKTAAELLQSQGSQAGGSQTLK RDKEKKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665799 |
| Locus ID | 23157 |
| UniProt ID | Q14141 |
| Refseq Size | 2620 |
| Cytogenetics | Xq24 |
| Refseq ORF | 1281 |
| Synonyms | SEP2; SEPT2; SEPT6 |
| Summary | This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402410 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407883 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407884 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC407885 | 42253 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402410 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant II |
CNY 3,080.00 |
|
| LY407883 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant I |
CNY 3,080.00 |
|
| LY407884 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant III |
CNY 3,080.00 |
|
| LY407885 | Transient overexpression lysate of septin 6 (SEPT6), transcript variant V |
CNY 3,080.00 |
|
| PH304244 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665801) |
CNY 19,520.00 |
|
| PH306957 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_055944) |
CNY 19,520.00 |
|
| PH309634 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665798) |
CNY 19,520.00 |
|
| PH318686 | SEPT6 MS Standard C13 and N15-labeled recombinant protein (NP_665799) |
CNY 19,520.00 |
|
| TP304244 | Recombinant protein of human septin 6 (SEPT6), transcript variant V, 20 µg |
CNY 2,900.00 |
|
| TP306957 | Recombinant protein of human septin 6 (SEPT6), transcript variant II, 20 µg |
CNY 2,900.00 |
|
| TP309634 | Recombinant protein of human septin 6 (SEPT6), transcript variant I, 20 µg |
CNY 2,900.00 |
其它SEPTIN6产品
