NDUF3 (NDUFAF3) (NM_199417) Human Recombinant Protein
CAT#: TP318529
Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 5, 20 µg
View other "NDUF3" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218529 representing NM_199417
Red=Cloning site Green=Tags(s) MATALALRSLYRARPSLRCPPVELPWAPRRGHRLSPADDELYQRTRISLLQREAAQAMYIDSYNSRGFMI NGNRVLGPCALLPHSVVQWNVGSHQDITEDSFSLFWLLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIA VEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_955449 |
Locus ID | 25915 |
UniProt ID | Q9BU61 |
Refseq Size | 1511 |
Cytogenetics | 3p21.31 |
Refseq ORF | 384 |
Synonyms | 2P1; C3orf60; DKFZp564J0123; E3-3; MGC10527 |
Summary | This gene encodes a mitochondrial complex I assembly protein that interacts with complex I subunits. Mutations in this gene cause mitochondrial complex I deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404729 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404730 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404732 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404733 | NDUFAF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404729 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY404730 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
LY404732 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
LY404733 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 3 (NDUFAF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3,080.00 |
|
PH302480 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951056) |
CNY 14,250.00 |
|
PH310699 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951032) |
CNY 19,520.00 |
|
PH317632 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951033) |
CNY 14,250.00 |
|
PH317754 | NDUFAF3 MS Standard C13 and N15-labeled recombinant protein (NP_951047) |
CNY 14,250.00 |
|
TP302480 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP310699 | Recombinant protein of human chromosome 3 open reading frame 60 (C3orf60), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317632 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP317754 | Purified recombinant protein of Homo sapiens chromosome 3 open reading frame 60 (C3orf60), transcript variant 3, 20 µg |
CNY 2,900.00 |