DYNLT1 (NM_006519) Human Recombinant Protein
CAT#: TP318331
Recombinant protein of human dynein, light chain, Tctex-type 1 (DYNLT1), 20 µg
View other "DYNLT1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218331 representing NM_006519
Red=Cloning site Green=Tags(s) MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIM QKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006510 |
Locus ID | 6993 |
UniProt ID | P63172 |
Refseq Size | 713 |
Cytogenetics | 6q25.3 |
Refseq ORF | 339 |
Synonyms | CW-1; TCTEL1; tctex-1; TCTEX1 |
Summary | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Dynein Light Chain 1 (DYNLT1) Interacts with Normal and Oncogenic Nucleoporins
,null,
PLoS ONE
,PubMed ID 23840580
[DYNLT1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401953 | DYNLT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401953 | Transient overexpression lysate of dynein, light chain, Tctex-type 1 (DYNLT1) |
CNY 3,080.00 |
|
PH318331 | DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510) |
CNY 19,520.00 |