JMJD6 (NM_001081461) Human Recombinant Protein
CAT#: TP318163
Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg
View other "JMJD6" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 2 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218163 representing NM_001081461
Red=Cloning site Green=Tags(s) MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSRIRDTCGGRAHP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001074930 |
Locus ID | 23210 |
UniProt ID | Q6NYC1 |
Refseq Size | 5445 |
Cytogenetics | 17q25.1 |
Refseq ORF | 1242 |
Synonyms | PSR; PTDSR; PTDSR1 |
Summary | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Citations (2)
The use of this Proteins has been cited in the following citations: |
---|
JMJD6 regulates histone H2A.X phosphorylation and promotes autophagy in triple-negative breast cancer cells via a novel tyrosine kinase activity
,Liu, Y;Long, YH;Wang, SQ;Zhang, YY;Li, YF;Mi, JS;Yu, CH;Li, DY;Zhang, JH;Zhang, XJ;,
Oncogene
,PubMed ID 30185813
[JMJD6]
|
Redistribution of demethylated RNA helicase A during foot-and-mouth disease virus infection: Role of Jumonji C-domain containing protein 6 in RHA demethylation
,Lawrence, P;Conderino, JS;Rieder, E;,
Virology, 3 2014.
[JMJD6]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414758 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421156 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414758 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 |
CNY 3,080.00 |
|
LY421156 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 |
CNY 3,080.00 |
|
PH308993 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982) |
CNY 19,520.00 |
|
PH318163 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) |
CNY 19,520.00 |
|
TP308993 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg |
CNY 2,900.00 |