United States
Germany
Japan
United Kingdom
China
SYTL2 (NM_032379) Human Recombinant Protein
CAT＃: TP318076
Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant b, 20 µg
View other "SYTL2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218076 representing NM_032379
Red=Cloning site Green=Tags(s) MSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEV KGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNE ILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAEN RGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKT TNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWE KMVNSPNTWIEATLPLRMLLIAKISK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115755 |
| Locus ID | 54843 |
| UniProt ID | Q9HCH5 |
| Refseq Size | 2407 |
| Cytogenetics | 11q14.1 |
| Refseq ORF | 1128 |
| Synonyms | CHR11SYT; EXO4; SGA72M; SLP2; SLP2A |
| Summary | The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jun 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403206 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC404177 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404178 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410172 | SYTL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403206 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant a |
CNY 4,840.00 |
|
| LY404177 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant e |
CNY 3,080.00 |
|
| LY404178 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant f |
CNY 3,080.00 |
|
| LY410172 | Transient overexpression lysate of synaptotagmin-like 2 (SYTL2), transcript variant b |
CNY 3,080.00 |
|
| PH317584 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_116561) |
CNY 19,520.00 |
|
| PH317701 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_996812) |
CNY 19,520.00 |
|
| PH318076 | SYTL2 MS Standard C13 and N15-labeled recombinant protein (NP_115755) |
CNY 19,520.00 |
|
| TP317584 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant a, 20 µg |
CNY 2,900.00 |
|
| TP317701 | Recombinant protein of human synaptotagmin-like 2 (SYTL2), transcript variant e, 20 µg |
CNY 2,900.00 |
