Cyclin Y (CCNY) (NM_145012) Human Recombinant Protein
CAT#: TP317807
Purified recombinant protein of Homo sapiens cyclin Y (CCNY), transcript variant 1, 20 µg
View other "Cyclin Y" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217807 representing NM_145012
Red=Cloning site Green=Tags(s) MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 39.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659449 |
Locus ID | 219771 |
UniProt ID | Q8ND76 |
Refseq Size | 2135 |
Cytogenetics | 10p11.21 |
Refseq ORF | 1023 |
Synonyms | C10orf9; CBCP1; CCNX; CFP1 |
Summary | Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Cyclin Y, a novel actin-binding protein, regulates spine plasticity through the cofilin-actin pathway
,Hwang, H;Hur, YN;Sohn, H;Seo, J;Hong, JH;Cho, E;Choi, Y;Lee, S;Song, S;Lee, AR;Kim, S;Jo, DG;Rhim, H;Park, M;,
Prog. Neurobiol.
,PubMed ID 32966834
[CCNY]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408148 | CCNY HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408148 | Transient overexpression lysate of cyclin Y (CCNY), transcript variant 1 |
CNY 3,080.00 |
|
PH317807 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_659449) |
CNY 14,250.00 |
|
PH320991 | CCNY MS Standard C13 and N15-labeled recombinant protein (NP_859049) |
CNY 19,520.00 |
|
TP320991 | Recombinant protein of human cyclin Y (CCNY), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Cyclin Y产品