United States
Germany
Japan
United Kingdom
China
PSMD10 (NM_170750) Human Recombinant Protein
CAT＃: TP317359
Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2, 20 µg
View other "PSMD10" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217359 representing NM_170750
Red=Cloning site Green=Tags(s) MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA TAMHRAAAKDT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 16 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_736606 |
| Locus ID | 5716 |
| UniProt ID | O75832 |
| Refseq Size | 1467 |
| Cytogenetics | Xq22.3 |
| Refseq ORF | 453 |
| Synonyms | dJ889N15.2; p28; p28(GANK) |
| Summary | This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406867 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419094 | PSMD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406867 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 2 |
CNY 3,080.00 |
|
| LY419094 | Transient overexpression lysate of proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
CNY 3,080.00 |
|
| PH302025 | PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_002805) |
CNY 19,520.00 |
|
| PH317359 | PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_736606) |
CNY 19,520.00 |
|
| TP302025 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720144 | Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1 |
CNY 3,140.00 |
