CCBL2 (KYAT3) (NM_001008662) Human Recombinant Protein
CAT#: TP317351
Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2, 20 µg
View other "CCBL2" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217351 representing NM_001008662
Red=Cloning site Green=Tags(s) MSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHP SLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPV FIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCI SDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCA TPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDL SDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008662 |
Locus ID | 56267 |
UniProt ID | Q6YP21 |
Refseq Size | 1938 |
Cytogenetics | 1p22.2 |
Refseq ORF | 1260 |
Synonyms | CCBL2; KAT3; KATIII |
Summary | This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423344 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC423345 | CCBL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY423344 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1 |
CNY 4,840.00 |
|
LY423345 | Transient overexpression lysate of cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 2 |
CNY 4,840.00 |
|
PH314155 | CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008661) |
CNY 19,520.00 |
|
PH317351 | CCBL2 MS Standard C13 and N15-labeled recombinant protein (NP_001008662) |
CNY 19,520.00 |
|
TP314155 | Recombinant protein of human cysteine conjugate-beta lyase 2 (CCBL2), transcript variant 1, 20 µg |
CNY 2,900.00 |