United States
Germany
Japan
United Kingdom
China
G CSF (CSF3) (NM_000759) Human Recombinant Protein
CAT＃: TP317237
Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, 20 µg
View other "G CSF" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC217237 representing NM_000759
Red=Cloning site Green=Tags(s) MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECA TYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQ LDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000750 |
| Locus ID | 1440 |
| UniProt ID | P09919 |
| Refseq Size | 1518 |
| Cytogenetics | 17q21.1 |
| Refseq ORF | 621 |
| Synonyms | C17orf33; CSF3OS; GCSF |
| Summary | This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2020] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400258 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC403533 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432626 | CSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400258 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1 |
CNY 3,080.00 |
|
| LY403533 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 3,080.00 |
|
| LY432626 | Transient overexpression lysate of colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4 |
CNY 3,080.00 |
|
| PH307709 | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374) |
CNY 19,520.00 |
|
| PH317237 | CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_000750) |
CNY 19,520.00 |
|
| TP307709 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP329626 | Purified recombinant protein of Homo sapiens colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP720002 | Recombinant protein of human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 1, produced in E. coli |
CNY 3,140.00 |
|
| TP723770 | Purified recombinant protein of Human colony stimulating factor 3 (granulocyte) (CSF3), transcript variant 3 |
CNY 5,150.00 |
