Vasopressin (AVP) (NM_000490) Human Recombinant Protein
CAT#: TP316816
Recombinant protein of human arginine vasopressin (AVP), 20 µg
View other "Vasopressin" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216816 representing NM_000490
Red=Cloning site Green=Tags(s) MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTA EALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAG ALLLRLVQLAGAPEPFEPAQPDAY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000481 |
Locus ID | 551 |
UniProt ID | P01185 |
Refseq Size | 633 |
Cytogenetics | 20p13 |
Refseq ORF | 492 |
Synonyms | ADH; ARVP; AVP-NPII; AVRP; VP |
Summary | This gene encodes a member of the vasopressin/oxytocin family and preproprotein that is proteolytically processed to generate multiple protein products. These products include the neuropeptide hormone arginine vasopressin, and two other peptides, neurophysin 2 and copeptin. Arginine vasopressin is a posterior pituitary hormone that is synthesized in the supraoptic nucleus and paraventricular nucleus of the hypothalamus. Along with its carrier protein, neurophysin 2, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis where it is either stored or secreted into the bloodstream. The precursor is thought to be activated while it is being transported along the axon to the posterior pituitary. Arginine vasopressin acts as a growth factor by enhancing pH regulation through acid-base transport systems. It has a direct antidiuretic action on the kidney, and also causes vasoconstriction of the peripheral vessels. This hormone can contract smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. Mutations in this gene cause autosomal dominant neurohypophyseal diabetes insipidus (ADNDI). This gene is present in a gene cluster with the related gene oxytocin on chromosome 20. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Soluble ACE2-mediated cell entry of SARS-CoV-2 via interaction with proteins related to the renin-angiotensin system
,Yeung, ML;Teng, JLL;Jia, L;Zhang, C;Huang, C;Cai, JP;Zhou, R;Chan, KH;Zhao, H;Zhu, L;Siu, KL;Fung, SY;Yung, S;Chan, TM;To, KK;Chan, JF;Cai, Z;Lau, SKP;Chen, Z;Jin, DY;Woo, PCY;Yuen, KY;,
Cell
,PubMed ID 33713620
[AVP]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424686 | AVP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424686 | Transient overexpression lysate of arginine vasopressin (AVP) |
CNY 3,080.00 |
|
PH316816 | AVP MS Standard C13 and N15-labeled recombinant protein (NP_000481) |
CNY 19,520.00 |
|
TP701053 | Purified recombinant protein of Human arginine vasopressin (AVP), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7,106.00 |
其它Vasopressin产品