ARHGEF9 (NM_015185) Human Recombinant Protein
CAT#: TP316681
Recombinant protein of human Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), 20 µg
View other "ARHGEF9" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216681 representing NM_015185
Red=Cloning site Green=Tags(s) MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQED EVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMF SDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSK LMKDSRYQHFFEACRLLQQMIDIAIDGFLLTLVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNV TQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLC KKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQ VFEFTEPKRSQSPFWQNFSRLTPFKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056000 |
Locus ID | 23229 |
UniProt ID | O43307 |
Refseq Size | 5413 |
Cytogenetics | Xq11.1 |
Refseq ORF | 1548 |
Synonyms | COLLYBISTIN; DEE8; EIEE8; HPEM-2; PEM-2; PEM2 |
Summary | The protein encoded by this gene is a Rho-like GTPase that switches between the active (GTP-bound) state and inactive (GDP-bound) state to regulate CDC42 and other genes. This brain-specific protein also acts as an adaptor protein for the recruitment of gephyrin and together these proteins facilitate receceptor recruitement in GABAnergic and glycinergic synapses. Defects in this gene are the cause of startle disease with epilepsy (STHEE), also known as hyperekplexia with epilepsy, as well as several other types of cognitive disability. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414739 | ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC433127 | ARHGEF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414739 | Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9) |
CNY 4,840.00 |
|
LY433127 | Transient overexpression lysate of Cdc42 guanine nucleotide exchange factor (GEF) 9 (ARHGEF9), transcript variant 2 |
CNY 3,080.00 |
|
PH316681 | ARHGEF9 MS Standard C13 and N15-labeled recombinant protein (NP_056000) |
CNY 19,520.00 |
其它ARHGEF9产品