SLAMF8 (NM_020125) Human Recombinant Protein
CAT#: TP316603
Recombinant protein of human SLAM family member 8 (SLAMF8), 20 µg
View other "SLAMF8" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216603 protein sequence
Red=Cloning site Green=Tags(s) MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLET LYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDA QPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWD LATVTPWDSCHHEAAPGKASYKDVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPL VQDLP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_064510 |
Locus ID | 56833 |
UniProt ID | Q9P0V8 |
Refseq Size | 3316 |
Cytogenetics | 1q23.2 |
Refseq ORF | 855 |
Synonyms | BLAME; CD353; SBBI42 |
Summary | This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment. The gene is found in a region of chromosome 1 containing many CD2 genes. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412665 | SLAMF8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412665 | Transient overexpression lysate of SLAM family member 8 (SLAMF8) |
CNY 3,080.00 |
|
PH316603 | SLAMF8 MS Standard C13 and N15-labeled recombinant protein (NP_064510) |
CNY 19,520.00 |