Sialidase 3 (NEU3) (NM_006656) Human Recombinant Protein
CAT#: TP316537
Recombinant protein of human sialidase 3 (membrane sialidase) (NEU3), 20 µg
View other "Sialidase 3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 3 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216537 representing NM_006656
Red=Cloning site Green=Tags(s) MRPADLPPRPMEESPASSSAPTETEEPGSSAEVMEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHT FLAFAEKRSTRRDEDALHLVLRRGLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICV RGHVTERQQIVSGRNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIP AYTYYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVLYCSARTP NRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSSKDAPTIQQSSPGSSLRL EEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFE CGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFKSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 29118338) |
Reference Data | |
RefSeq | NP_006647 |
Locus ID | 10825 |
UniProt ID | Q9UQ49 |
Refseq Size | 2748 |
Cytogenetics | 11q13.4 |
Refseq ORF | 1383 |
Synonyms | SIAL3 |
Summary | This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating the ganglioside content of the lipid bilayer. [provided by RefSeq, Jul 2008] |
Protein Pathways | Other glycan degradation, Sphingolipid metabolism |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
Reduced Sialylation and Bioactivity of the Antifibrotic Protein Serum Amyloid P in the Sera of Patients with Idiopathic Pulmonary Fibrosis
,Chen, W;Karhadkar, TR;Ryu, C;Herzog, EL;Gomer, RH;,
Immunohorizons
,PubMed ID 32576593
[NEU3]
|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU3]
|
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
,Karhadkar, TR;Pilling, D;Cox, N;Gomer, RH;,
Sci Rep
,PubMed ID 29118338
[NEU3]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401990 | NEU3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401990 | Transient overexpression lysate of sialidase 3 (membrane sialidase) (NEU3) |
CNY 4,840.00 |
|
PH316537 | NEU3 MS Standard C13 and N15-labeled recombinant protein (NP_006647) |
CNY 19,520.00 |
其它Sialidase 3产品