NY-ESO-1 (CTAG1A) (NM_139250) Human Recombinant Protein

CAT#: TP316285

Recombinant protein of human cancer/testis antigen 1A (CTAG1A), 20 µg

Size: 20 ug 100 ug 1 mg



  View other "NY-ESO-1" proteins (3)

Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00

CNY 6,650.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-CTAG1A/B Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC216285 protein sequence
Red=Cloning site Green=Tags(s)

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_640343
Locus ID 246100
UniProt ID P78358
Refseq Size 748
Cytogenetics Xq28
Refseq ORF 540
Synonyms CT6.1; ESO1; LAGE-2; LAGE2A; NY-ESO-1
Summary The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Other Versions

Customer Reviews 
Loading...