NY-ESO-1 (CTAG1A) (NM_139250) Human Recombinant Protein
CAT#: TP316285
Recombinant protein of human cancer/testis antigen 1A (CTAG1A), 20 µg
View other "NY-ESO-1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216285 protein sequence
Red=Cloning site Green=Tags(s) MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_640343 |
Locus ID | 246100 |
UniProt ID | P78358 |
Refseq Size | 748 |
Cytogenetics | Xq28 |
Refseq ORF | 540 |
Synonyms | CT6.1; ESO1; LAGE-2; LAGE2A; NY-ESO-1 |
Summary | The protein encoded by this gene is a tumor cell antigen found in various types of cancers, which makes it a good candidate for a cancer vaccine. This gene is also highly expressed in normal ovary and testis tissues. An identical copy of this gene is found on the same chromosome. [provided by RefSeq, Dec 2015] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408315 | CTAG1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408315 | Transient overexpression lysate of cancer/testis antigen 1A (CTAG1A) |
CNY 3,080.00 |
|
PH316285 | CTAG1A MS Standard C13 and N15-labeled recombinant protein (NP_640343) |
CNY 19,520.00 |
其它NY-ESO-1产品