BRN3A (POU4F1) (NM_006237) Human Recombinant Protein
CAT#: TP316284
Recombinant protein of human POU class 4 homeobox 1 (POU4F1), 20 µg
View other "BRN3A" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216284 representing NM_006237
Red=Cloning site Green=Tags(s) MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQ GKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAAGG GGAHDGPGGGGGPGGGGGPGGGPGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHSLGHLSHPAAAAAMNM PSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRI KLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELF NGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 42.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006228 |
Locus ID | 5457 |
UniProt ID | Q01851 |
Refseq Size | 3824 |
Cytogenetics | 13q31.1 |
Refseq ORF | 1257 |
Synonyms | ATITHS; brn-3A; BRN3A; Oct-T1; RDC-1 |
Summary | This gene encodes a member of the POU-IV class of neural transcription factors. This protein is expressed in a subset of retinal ganglion cells and may be involved in the developing sensory nervous system. This protein may also promote the growth of cervical tumors. A translocation of this gene is associated with some adult acute myeloid leukemias. [provided by RefSeq, Mar 2012] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416781 | POU4F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416781 | Transient overexpression lysate of POU class 4 homeobox 1 (POU4F1) |
CNY 4,840.00 |
|
PH316284 | POU4F1 MS Standard C13 and N15-labeled recombinant protein (NP_006228) |
CNY 14,250.00 |
|
TP762410 | Purified recombinant protein of Human Mass Spec Standard(BRN3A), with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |