MBNL3 (NM_018388) Human Recombinant Protein
CAT#: TP316043
Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant G, 20 µg
View other "MBNL3" proteins (13)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216043 representing NM_018388
Red=Cloning site Green=Tags(s) MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKGRCTRENCKYL HPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMTPSIPANPPMAFNPYIPHPGM GLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVCREFQRGNCTRGENDCRYAHPTDASMIEASD NTVTICMDYIKGRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGAT PVFNPTVFHCQQALTNLQLPQPAFIPAGPILCMAPASNIVPMMHGATPTTVSAATTPATSVPFAAPTTGN QLKF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060858 |
Locus ID | 55796 |
UniProt ID | Q9NUK0 |
Refseq Size | 2701 |
Cytogenetics | Xq26.2 |
Refseq ORF | 1062 |
Synonyms | CHCR; MBLX; MBLX39; MBXL |
Summary | This gene encodes a member of the muscleblind-like family of proteins. The encoded protein may function in regulation of alternative splicing and may play a role in the pathophysiology of myotonic dystrophy. Alternatively spliced transcript variants have been described. [provided by RefSeq, Dec 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408817 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413087 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432842 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432854 | MBNL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408817 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 2 |
CNY 3,080.00 |
|
LY413087 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 1 |
CNY 3,080.00 |
|
LY432842 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4 |
CNY 3,080.00 |
|
LY432854 | Transient overexpression lysate of muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3 |
CNY 3,080.00 |
|
PH316043 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_060858) |
CNY 14,250.00 |
|
PH316093 | MBNL3 MS Standard C13 and N15-labeled recombinant protein (NP_597846) |
CNY 19,520.00 |
|
TP316093 | Recombinant protein of human muscleblind-like 3 (Drosophila) (MBNL3), transcript variant R, 20 µg |
CNY 2,900.00 |
|
TP329842 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP329854 | Purified recombinant protein of Homo sapiens muscleblind-like 3 (Drosophila) (MBNL3), transcript variant 3, 20 µg |
CNY 2,900.00 |