Estrogen Related Receptor beta (ESRRB) (NM_004452) Human Recombinant Protein
CAT#: TP315995
Purified recombinant protein of Homo sapiens estrogen-related receptor beta (ESRRB), 20 µg
View other "Estrogen Related Receptor beta" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215995 representing NM_004452
Red=Cloning site Green=Tags(s) MSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGT PCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCP ATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLT KIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAW MEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALA NSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVP MHKLFLEMLEAKAWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPLPPPPSVAWVGTAQAGYHLEVFL PQRAGWPRAA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004443 |
Locus ID | 2103 |
UniProt ID | O95718 |
Refseq Size | 2193 |
Cytogenetics | 14q24.3 |
Refseq ORF | 1500 |
Synonyms | DFNB35; ERR2; ERRb; ERR beta-2; ERRbeta2; ESRL2; NR3B2 |
Summary | This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401414 | ESRRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC432280 | ESRRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401414 | Transient overexpression lysate of estrogen-related receptor beta (ESRRB) |
CNY 4,840.00 |
|
LY432280 | Transient overexpression lysate of estrogen-related receptor beta (ESRRB) |
CNY 3,080.00 |
|
PH315995 | ESRRB MS Standard C13 and N15-labeled recombinant protein (NP_004443) |
CNY 14,250.00 |
其它Estrogen Related Receptor beta产品