MACROD2 (NM_001033087) Human Recombinant Protein
CAT#: TP315636
Recombinant protein of human MACRO domain containing 2 (MACROD2), transcript variant 2, 20 µg
View other "MACROD2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215636 protein sequence
Red=Cloning site Green=Tags(s) MNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDADGVNTVTVPGPASEEAVEDCKDEDFA KDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYMETEELSSNQEDAVIVEQPEVIPLTE DQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDVEMNSQVDKVNDPTESQQEDQLIAGAQDEAKEQRN GTK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001028259 |
Locus ID | 140733 |
UniProt ID | A1Z1Q3 |
Refseq Size | 4425 |
Cytogenetics | 20p12.1 |
Refseq ORF | 639 |
Synonyms | C2orf133; C20orf133 |
Summary | The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Sindbis Macrodomain Poly-ADP-Ribose Hydrolase Activity Is Important for Viral RNA Synthesis.
,null,
Journal of virology
,PubMed ID 35297669
[MACROD2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409100 | MACROD2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY409100 | Transient overexpression lysate of MACRO domain containing 2 (MACROD2), transcript variant 1 |
CNY 4,840.00 |
|
PH315636 | MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_001028259) |
CNY 19,520.00 |
|
PH322689 | MACROD2 MS Standard C13 and N15-labeled recombinant protein (NP_542407) |
CNY 14,250.00 |
|
TP322689 | Purified recombinant protein of Homo sapiens MACRO domain containing 2 (MACROD2), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它MACROD2产品