DNAJC9 (NM_015190) Human Recombinant Protein
CAT#: TP315630
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9), 20 µg
View other "DNAJC9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215630 representing NM_015190
Red=Cloning site Green=Tags(s) MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLS DREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGD MDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLD EGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056005 |
Locus ID | 23234 |
UniProt ID | Q8WXX5 |
Refseq Size | 1450 |
Cytogenetics | 10q22.2 |
Refseq ORF | 780 |
Synonyms | HDJC9; JDD1; SB73 |
Summary | May play a role as co-chaperone of the Hsp70 family proteins HSPA1A, HSPA1B and HSPA8.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414688 | DNAJC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414688 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 9 (DNAJC9) |
CNY 3,080.00 |
|
PH315630 | DNAJC9 MS Standard C13 and N15-labeled recombinant protein (NP_056005) |
CNY 19,520.00 |