United States
Germany
Japan
United Kingdom
China
Growth Arrest Specific Protein 7 (GAS7) (NM_003644) Human Recombinant Protein
CAT＃: TP315256
Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a, 20 µg
View other "Growth Arrest Specific Protein 7" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC215256 representing NM_003644
Red=Cloning site Green=Tags(s) MSNMENSFDDVSCLSPQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSYCDYFWADKKD PQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGSLGEAWAQVKK SLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDL EMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELERLEVERVEMIR QHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003635 |
| Locus ID | 8522 |
| UniProt ID | O60861 |
| Refseq Size | 7773 |
| Cytogenetics | 17p13.1 |
| Refseq ORF | 1008 |
| Summary | Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404414 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404415 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC418527 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404414 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b |
CNY 3,080.00 |
|
| LY404415 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c |
CNY 4,840.00 |
|
| LY418527 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a |
CNY 3,080.00 |
|
| PH300285 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) |
CNY 19,520.00 |
|
| PH315256 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) |
CNY 19,520.00 |
|
| TP300285 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b, 20 µg |
CNY 2,900.00 |
|
| TP720200 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d |
CNY 3,140.00 |
其它Growth Arrest Specific Protein 7产品
