HSPB2 (NM_001541) Human Recombinant Protein
CAT#: TP314718
Recombinant protein of human heat shock 27kDa protein 2 (HSPB2), 20 µg
View other "HSPB2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214718 protein sequence
Red=Cloning site Green=Tags(s) MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLS EGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDG ILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001532 |
Locus ID | 3316 |
UniProt ID | Q16082 |
Refseq Size | 858 |
Cytogenetics | 11q23.1 |
Refseq ORF | 546 |
Synonyms | Hs.78846; HSP27; LOH11CR1K; MKBP |
Summary | The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function. [provided by RefSeq, Dec 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419871 | HSPB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419871 | Transient overexpression lysate of heat shock 27kDa protein 2 (HSPB2) |
CNY 3,080.00 |
|
PH314718 | HSPB2 MS Standard C13 and N15-labeled recombinant protein (NP_001532) |
CNY 19,520.00 |
|
TP721195 | Purified recombinant protein of Human heat shock 27kDa protein 2 (HSPB2) |
CNY 3,140.00 |