YY1 associated factor 2 (YAF2) (NM_005748) Human Recombinant Protein
CAT#: TP314071
Recombinant protein of human YY1 associated factor 2 (YAF2), 20 µg
View other "YY1 associated factor 2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214071 representing NM_005748
Red=Cloning site Green=Tags(s) MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005739 |
Locus ID | 10138 |
UniProt ID | Q8IY57 |
Refseq Size | 4096 |
Cytogenetics | 12q12 |
Refseq ORF | 540 |
Summary | This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators, including Myc and Polycomb. This protein can promote proteolysis of Yy1. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417096 | YAF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417096 | Transient overexpression lysate of YY1 associated factor 2 (YAF2) |
CNY 3,080.00 |
|
PH314071 | YAF2 MS Standard C13 and N15-labeled recombinant protein (NP_005739) |
CNY 19,520.00 |
其它YY1 associated factor 2产品