MEK7 (MAP2K7) (NM_145185) Human Recombinant Protein
CAT#: TP313868
Recombinant protein of human mitogen-activated protein kinase kinase 7 (MAP2K7), 20 µg
View other "MEK7" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213868 representing NM_145185
Red=Cloning site Green=Tags(s) MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPAR PRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFR KTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRM QGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGC AAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFS GDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660186 |
Locus ID | 5609 |
UniProt ID | O14733 |
Refseq Size | 3386 |
Cytogenetics | 19p13.2 |
Refseq ORF | 1257 |
Synonyms | JNKK2; MAPKK7; MEK; MEK 7; MKK7; PRKMK7; SAPKK-4; SAPKK4 |
Summary | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2,MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | ErbB signaling pathway, Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408043 | MAP2K7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408043 | Transient overexpression lysate of mitogen-activated protein kinase kinase 7 (MAP2K7) |
CNY 4,840.00 |
|
PH313868 | MAP2K7 MS Standard C13 and N15-labeled recombinant protein (NP_660186) |
CNY 19,520.00 |
|
TP750167 | Purified recombinant protein of Human mitogen-activated protein kinase kinase 7 (MAP2K7), full length, with C-terminal His tag, expressed in E.coli, 50ug |
CNY 1,948.00 |