United States
Germany
Japan
United Kingdom
China
PPM1G (NM_177983) Human Recombinant Protein
CAT＃: TP313685
Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1, 20 µg
View other "PPM1G" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC213685 protein sequence
Red=Cloning site Green=Tags(s) MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNCIPELDSETAMFSVYDGHGGEEVALY CAKYLPDIIKDQKAYKEGKLQKALEDAFLAIDAKLTTEEVIKELAQIAGRPTEDEDEKEKVADEDDVDNE EAALLHEEATMTIEELLTRYGQNCHKGPPHSKSGGGTGEEPGSQGLNGEAGPEDSTRETPSQENGPTAKA YTGFSSNSERGTEAGQVGEPGIPTGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEAEEEEEDSEECSEE EDGYSSEEAENEEDEDDTEEAEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSR CVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISA LPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSG DGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro phosphatase assay (PMID: 25658463) |
| Reference Data | |
| RefSeq | NP_817092 |
| Locus ID | 5496 |
| UniProt ID | O15355 |
| Refseq Size | 2302 |
| Cytogenetics | 2p23.3 |
| Refseq ORF | 1638 |
| Synonyms | PP2CG; PP2CGAMMA; PPP2CG |
| Summary | The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 2010] |
| Protein Families | Druggable Genome, Phosphatase |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
WIP1 Phosphatase as a Potential Therapeutic Target in Neuroblastoma
,Richter, M;Dayaram, T;Gilmartin, AG;Ganji, G;Pemmasani, SK;Van Der Key, H;Shohet, JM;Donehower, LA;Kumar, R;,
PLoS ONE
,PubMed ID 25658463
[PPM1G]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400953 | PPM1G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406071 | PPM1G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400953 | Transient overexpression lysate of protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 2 |
CNY 3,080.00 |
|
| LY406071 | Transient overexpression lysate of protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1 |
CNY 3,080.00 |
|
| PH300439 | PPM1G MS Standard C13 and N15-labeled recombinant protein (NP_002698) |
CNY 19,520.00 |
|
| PH313685 | PPM1G MS Standard C13 and N15-labeled recombinant protein (NP_817092) |
CNY 19,520.00 |
|
| TP300439 | Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP720138 | Recombinant protein of human protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform (PPM1G), transcript variant 1 |
CNY 3,140.00 |
