ACVRL1 (NM_001077401) Human Recombinant Protein
CAT#: TP313389
Recombinant protein of human activin A receptor type II-like 1 (ACVRL1), transcript variant 2, 20 µg
View other "ACVRL1" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC213389 protein sequence
Red=Cloning site Green=Tags(s) MTLGSPRKGLLMLLMALVTQGDPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCG NLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQLALILGPVLALLALVALGVLGL WHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVARQVALVECVGK GRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDMTSRNSSTQLWLITHYH EHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHRDFKSRNVLVKSNLQCCIADLG LAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYKWTDIWAFGLVLWEIARRTIVNGIVED YRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPNRLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQ KISNSPEKPKVIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001070869 |
Locus ID | 94 |
UniProt ID | P37023 |
Refseq Size | 4126 |
Cytogenetics | 12q13.13 |
Refseq ORF | 1509 |
Synonyms | ACVRLK1; ALK-1; ALK1; HHT; HHT2; ORW2; SKR3; TSR-I |
Summary | This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421410 | ACVRL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY421410 | Transient overexpression lysate of activin A receptor type II-like 1 (ACVRL1), transcript variant 2 |
CNY 4,840.00 |
|
PH313389 | ACVRL1 MS Standard C13 and N15-labeled recombinant protein (NP_001070869) |
CNY 19,520.00 |
|
TP761932 | Purified recombinant protein of Human activin A receptor type II-like 1 (ACVRL1), transcript variant 1,Asp22-Leu119, with N-terminal His-ABP tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
TP762552 | Purified recombinant protein of Human activin A receptor type II-like 1 (ACVRL1), transcript variant 1, 50ug |
CNY 2,480.00 |