CTNNBIP1 (NM_001012329) Human Recombinant Protein
CAT#: TP312922
Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2, 20 µg
View other "CTNNBIP1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212922 representing NM_001012329
Red=Cloning site Green=Tags(s) MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA FSRSETEDRRQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001012329 |
Locus ID | 56998 |
UniProt ID | Q9NSA3, A0A024R4D7 |
Refseq Size | 2961 |
Cytogenetics | 1p36.22 |
Refseq ORF | 243 |
Synonyms | ICAT |
Summary | The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412546 | CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423325 | CTNNBIP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412546 | Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1 |
CNY 3,080.00 |
|
LY423325 | Transient overexpression lysate of catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 2 |
CNY 3,080.00 |
|
PH312922 | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001012329) |
CNY 19,520.00 |
|
PH316082 | CTNNBIP1 MS Standard C13 and N15-labeled recombinant protein (NP_064633) |
CNY 19,520.00 |
|
TP316082 | Recombinant protein of human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它CTNNBIP1产品