SCYL1BP1 (GORAB) (NM_152281) Human Recombinant Protein
CAT#: TP312883
Recombinant protein of human golgin, RAB6-interacting (GORAB), 20 µg
View other "SCYL1BP1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212883 representing NM_152281
Red=Cloning site Green=Tags(s) MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALV EQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENS HDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKL KRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDRAEAEYIAAKLDIQRKTEIKEQLTEHLCTI IQQNELRKAKKLEELMQQLDVEADEETLELEVEVERLLHEQEVESRRPVVRLERPFQPAEESVTLEFAKE NRKCQEQAVSPKVDDQCGNSSSIPFLSPNCPNQEGNDISAALAT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_689494 |
Locus ID | 92344 |
UniProt ID | Q5T7V8 |
Refseq Size | 2186 |
Cytogenetics | 1q24.2 |
Refseq ORF | 1182 |
Synonyms | GO; NTKLBP1; SCYL1BP1 |
Summary | This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407701 | GORAB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407701 | Transient overexpression lysate of golgin, RAB6-interacting (GORAB), transcript variant 1 |
CNY 3,080.00 |
|
PH312883 | GORAB MS Standard C13 and N15-labeled recombinant protein (NP_689494) |
CNY 19,520.00 |
其它SCYL1BP1产品