ACBD5 (NM_145698) Human Recombinant Protein
CAT#: TP312795
Recombinant protein of human acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 1, 20 µg
View other "ACBD5" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212795 representing NM_145698
Red=Cloning site Green=Tags(s) MADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWS SLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSDLGNVLTSTPNA KTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHA SSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLD SFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHRE KRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVL QRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_663736 |
Locus ID | 91452 |
UniProt ID | Q5T8D3 |
Refseq Size | 2327 |
Cytogenetics | 10p12.1 |
Refseq ORF | 1470 |
Synonyms | RDLKD |
Summary | This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of platelets. A related protein in yeast is involved in autophagy of peroxisomes. A mutation in this gene has been associated with autosomal dominant thrombocytopenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420927 | ACBD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420927 | Transient overexpression lysate of acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 2 |
CNY 3,080.00 |
|
PH307033 | ACBD5 MS Standard C13 and N15-labeled recombinant protein (NP_001035938) |
CNY 19,520.00 |
|
TP307033 | Recombinant protein of human acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 2, 20 µg |
CNY 2,900.00 |