MSH5 (NM_172166) Human Recombinant Protein
CAT#: TP312608
Recombinant protein of human mutS homolog 5 (E. coli) (MSH5), transcript variant 4, 20 µg
View other "MSH5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212608 representing NM_172166
Red=Cloning site Green=Tags(s) MASLGANPRRTPQGPRPGAASSGFPSPAPVPGPREAEEEEVEEEEELAEIHLCVLWNSGYLGIAYYDTSD STIHFMPDAPDHESLKLLQRVLDEINPQSVVTSAKQDENMTRFLGKLASQEHREPKRPEIIFLPSVDFGL EISKQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILG FKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYKVASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHD LGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDAC RSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEV ARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALL GDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQN GRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDA IFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTC PHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVAR GKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 92.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_751898 |
Locus ID | 4439 |
UniProt ID | O43196 |
Refseq Size | 3968 |
Cytogenetics | 6p21.33 |
Refseq ORF | 2502 |
Synonyms | G7; MUTSH5; NG23; POF13 |
Summary | This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair and meiotic recombination. This protein is similar to a Saccharomyces cerevisiae protein that participates in segregation fidelity and crossing-over events during meiosis. This protein plays a role in promoting ionizing radiation-induced apoptosis. This protein forms hetero-oligomers with another member of this family, mutS homolog 4. Polymorphisms in this gene have been linked to various human diseases, including IgA deficiency, common variable immunodeficiency, and premature ovarian failure. Alternative splicing results multiple transcript variants. Read-through transcription also exists between this gene and the downstream chromosome 6 open reading frame 26 (C6orf26) gene. [provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406777 | MSH5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC419330 | MSH5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406777 | Transient overexpression lysate of mutS homolog 5 (E. coli) (MSH5), transcript variant 4 |
CNY 4,840.00 |
|
LY419330 | Transient overexpression lysate of mutS homolog 5 (E. coli) (MSH5), transcript variant 3 |
CNY 3,080.00 |
|
PH300607 | MSH5 MS Standard C13 and N15-labeled recombinant protein (NP_002432) |
CNY 19,520.00 |
|
PH312608 | MSH5 MS Standard C13 and N15-labeled recombinant protein (NP_751898) |
CNY 19,520.00 |
|
TP300607 | Recombinant protein of human mutS homolog 5 (E. coli) (MSH5), transcript variant 3, 20 µg |
CNY 2,900.00 |