Kallikrein 11 (KLK11) (NM_144947) Human Recombinant Protein
CAT#: TP312547
Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 2, 20 µg
View other "Kallikrein 11" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212547 representing NM_144947
Red=Cloning site Green=Tags(s) MQRLRWLRDWKSSGRGLTAAKEPGARSSPLQAMRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAA LFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHR NDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAY PGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMK NN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659196 |
Locus ID | 11012 |
UniProt ID | Q9UBX7 |
Refseq Size | 1289 |
Cytogenetics | 19q13.41 |
Refseq ORF | 846 |
Synonyms | PRSS20; TLSP |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing and the use of alternate promoters results in multiple transcript variants encoding distinct isoforms which are differentially expressed. [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Protease, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408096 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416376 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427779 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430122 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432810 | KLK11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408096 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3,080.00 |
|
LY416376 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 1 |
CNY 3,080.00 |
|
LY427779 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 4 |
CNY 3,080.00 |
|
LY430122 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 2 |
CNY 3,080.00 |
|
LY432810 | Transient overexpression lysate of kallikrein-related peptidase 11 (KLK11), transcript variant 3 |
CNY 3,080.00 |
|
PH306022 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_006844) |
CNY 14,250.00 |
|
PH312547 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_659196) |
CNY 19,520.00 |
|
PH327537 | KLK11 MS Standard C13 and N15-labeled recombinant protein (NP_001129504) |
CNY 19,520.00 |
|
TP306022 | Purified recombinant protein of Homo sapiens kallikrein-related peptidase 11 (KLK11), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327537 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr, 20 µg |
CNY 2,900.00 |
|
TP720310 | Recombinant protein of human kallikrein-related peptidase 11 (KLK11), transcript variant 1 prepropr |
CNY 3,140.00 |
其它Kallikrein 11产品