United States
Germany
Japan
United Kingdom
China
TBL1Y (NM_134259) Human Recombinant Protein
CAT＃: TP312240
Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 3, 20 µg
View other "TBL1Y" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212240 protein sequence
Red=Cloning site Green=Tags(s) MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPSALISILQKGLQYVEAEISINKDG TVFDSRPIESLSLIVAVIPDVVQMRQQAFGEKLTQQQASAAATEASAMAKAATMTPAAISQQNPPKNREA TVNGEENGAHEINNHSKPMEIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNE NSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLGQHKGPIF ALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDH PVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATSNPN SSIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVHSY QGTGGIFEVCWNARGDKVGASASDGSVCVLDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_599021 |
| Locus ID | 90665 |
| UniProt ID | Q9BQ87 |
| Refseq Size | 2312 |
| Cytogenetics | Yp11.2 |
| Refseq ORF | 1566 |
| Synonyms | DFNY2; TBL1 |
| Summary | The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. This gene is highly similar to TBL1X gene in nucleotide sequence and protein sequence, but the TBL1X gene is located on chromosome X and this gene is on chromosome Y. This gene has three alternatively spliced transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Wnt signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408755 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC408756 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409606 | TBL1Y HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY408755 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 2 |
CNY 4,840.00 |
|
| LY408756 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 3 |
CNY 4,840.00 |
|
| LY409606 | Transient overexpression lysate of transducin (beta)-like 1, Y-linked (TBL1Y), transcript variant 1 |
CNY 4,840.00 |
|
| PH312240 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599021) |
CNY 19,520.00 |
|
| PH314764 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_599020) |
CNY 19,520.00 |
|
| PH320139 | TBL1Y MS Standard C13 and N15-labeled recombinant protein (NP_150600) |
CNY 19,520.00 |
|
| TP314764 | Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP320139 | Recombinant protein of human transducin (beta)-like 1Y-linked (TBL1Y), transcript variant 1, 20 µg |
CNY 2,900.00 |
