WIPF1 (NM_001077269) Human Recombinant Protein
CAT#: TP312019
Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2, 20 µg
View other "WIPF1" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212019 representing NM_001077269
Red=Cloning site Green=Tags(s) MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILDKPKGAGAGGG GGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDNDSGGSRPPLLPPGGRSTSAKP FSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKPDSIPPPVPSTPRPIQSSLHNRGSPPVPGGP RQPSPGPTPPPFPGNRGTALGGGSIRQSPLSSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHRE AVPPPPPQNNKPPVPSTPRPSASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPS PGRSGPLPPPPSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNR RERGAPPLPPIPR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001070737 |
Locus ID | 7456 |
UniProt ID | O43516, A0A140VJZ9, Q2YDC4 |
Refseq Size | 4664 |
Cytogenetics | 2q31.1 |
Refseq ORF | 1509 |
Synonyms | PRPL-2; WAS2; WASPIP; WIP |
Summary | This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401163 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421397 | WIPF1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401163 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1 |
CNY 4,840.00 |
|
LY421397 | Transient overexpression lysate of WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 2 |
CNY 4,840.00 |
|
PH312019 | WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_001070737) |
CNY 19,520.00 |
|
PH317601 | WIPF1 MS Standard C13 and N15-labeled recombinant protein (NP_003378) |
CNY 19,520.00 |
|
TP317601 | Recombinant protein of human WAS/WASL interacting protein family, member 1 (WIPF1), transcript variant 1, 20 µg |
CNY 2,900.00 |