Oct4 (POU5F1) (NM_002701) Human Recombinant Protein
CAT#: TP311998
Recombinant protein of human POU class 5 homeobox 1 (POU5F1), transcript variant 1, 20 µg
View other "Oct4" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211998 representing NM_002701
Red=Cloning site Green=Tags(s) MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA assay (PMID: 25892221) |
Reference Data | |
RefSeq | NP_002692 |
Locus ID | 5460 |
UniProt ID | Q01860, D2IYK3 |
Refseq Size | 1417 |
Cytogenetics | 6p21.33 |
Refseq ORF | 1080 |
Synonyms | Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4 |
Summary | This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq, Oct 2013] |
Protein Families | Adult stem cells, Cancer stem cells, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
OCT4 accelerates tumorigenesis through activating JAK/STAT signaling in ovarian cancer side population cells
,null,
Cancer Management and Research
,PubMed ID 30643464
[POU5F1]
|
Pioneer transcription factors target partial DNA motifs on nucleosomes to initiate reprogramming
,Soufi, A;Garcia, MF;Jaroszewicz, A;Osman, N;Pellegrini, M;Zaret, KS;,
Cell
,PubMed ID 25892221
[POU5F1]
|
Acetylated histone H3K56 interacts with Oct4 to promote mouse embryonic stem cell pluripotency
,null,
Proceedings of the National Academy of Sciences of the United States of America
,PubMed ID 23798425
[POU5F1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400950 | POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404373 | POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400950 | Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 1 |
CNY 3,080.00 |
|
LY404373 | Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 2 |
CNY 3,080.00 |
|
PH311998 | POU5F1 MS Standard C13 and N15-labeled recombinant protein (NP_002692) |
CNY 19,520.00 |
|
TP760938 | Purified recombinant protein of Human POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |