VENTX (NM_014468) Human Recombinant Protein
CAT#: TP311761L
Recombinant protein of human VENT homeobox homolog (Xenopus laevis) (VENTX), 1 mg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36,000.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211761 protein sequence
Red=Cloning site Green=Tags(s) MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSPGSLPGPGQTSGAREPPQAVSIKEAAGSS NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055283 |
Locus ID | 27287 |
UniProt ID | O95231 |
Refseq Size | 2422 |
Cytogenetics | 10q26.3 |
Refseq ORF | 774 |
Synonyms | HPX42B; NA88A; VENTX2 |
Summary | This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |