United States
Germany
Japan
United Kingdom
China
TOX2 (NM_001098796) Human Recombinant Protein
CAT＃: TP311560
Recombinant protein of human TOX high mobility group box family member 2 (TOX2), transcript variant 4, 20 µg
View other "TOX2" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC211560 representing NM_001098796
Red=Cloning site Green=Tags(s) MSDGNPELLSTSQTYNGQSENNEDYEIPPITPPNLPEPSLLHLGDHEASYHSLCHGLTPNGLLPAYSYQA MDLPAIMVSNMLAQDSHLLSGQLPTIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQMGI RSSIAHSSPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNEPQKPVSA YALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSKSS PDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGSKSLLPGLSASPPP PPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQLAMSPSPPGPQDFPHISEFPS SSGSCSPGPSNPTSSGDWDSSYPSGECGISTCSLLPRDKSLYLT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001092266 |
| Locus ID | 84969 |
| UniProt ID | Q96NM4 |
| Refseq Size | 2433 |
| Cytogenetics | 20q13.12 |
| Refseq ORF | 1392 |
| Synonyms | C20orf100; dJ495O3.1; dJ1108D11.2; GCX-1; GCX1 |
| Summary | Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409809 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420333 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420334 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420335 | TOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY409809 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 3 |
CNY 4,840.00 |
|
| LY420333 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 4 |
CNY 4,840.00 |
|
| LY420334 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 1 |
CNY 4,840.00 |
|
| LY420335 | Transient overexpression lysate of TOX high mobility group box family member 2 (TOX2), transcript variant 2 |
CNY 4,840.00 |
|
| PH311560 | TOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001092266) |
CNY 19,520.00 |
