RFC4 (NM_181573) Human Recombinant Protein
CAT#: TP311392
Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2, 20 µg
View other "RFC4" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211392 representing NM_181573
Red=Cloning site Green=Tags(s) MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGAD LPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVREKVKNFAQLTVSGSRSDGKP CPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQR LLDIAKKENVKISDEGIAYLVKVSEGDLRKAITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAA CQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLIS LCATVMQQLSQNC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_853551 |
Locus ID | 5984 |
UniProt ID | P35249 |
Refseq Size | 1395 |
Cytogenetics | 3q27.3 |
Refseq ORF | 1089 |
Synonyms | A1; RFC37 |
Summary | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | DNA replication, Mismatch repair, Nucleotide excision repair |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405706 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419019 | RFC4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405706 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 2 |
CNY 3,080.00 |
|
LY419019 | Transient overexpression lysate of replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1 |
CNY 3,080.00 |
|
PH300426 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_002907) |
CNY 19,520.00 |
|
PH311392 | RFC4 MS Standard C13 and N15-labeled recombinant protein (NP_853551) |
CNY 19,520.00 |
|
TP300426 | Recombinant protein of human replication factor C (activator 1) 4, 37kDa (RFC4), transcript variant 1, 20 µg |
CNY 2,900.00 |