OTOS (NM_148961) Human Recombinant Protein
CAT#: TP311259M
Recombinant protein of human otospiralin (OTOS), 100 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9,998.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211259 protein sequence
Red=Cloning site Green=Tags(s) MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNYVQHFQALGAYPQIEDMARTF FAHFPLGSTLGFHVPYQED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_683764 |
Locus ID | 150677 |
UniProt ID | Q8NHW6 |
Refseq Size | 566 |
Cytogenetics | 2q37.3 |
Refseq ORF | 267 |
Synonyms | OTOSP |
Summary | Otospiralin is synthesized by nonsensory cells (fibrocytes) of the inner ear, and downregulation of otospiralin in guinea pigs leads to deafness (Lavigne-Rebillard et al., 2003 [PubMed 12687421]).[supplied by OMIM, Mar 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |