GPR73B (PROKR2) (NM_144773) Human Recombinant Protein
CAT#: TP311216
Recombinant protein of human prokineticin receptor 2 (PROKR2), 20 µg
View other "GPR73B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211216 representing NM_144773
Red=Cloning site Green=Tags(s) MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIG NFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLY VSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQ IWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCI LTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNRMINTVCFVTVKNNTMKYFKKMMLL HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_658986 |
Locus ID | 128674 |
UniProt ID | Q8NFJ6 |
Refseq Size | 1155 |
Cytogenetics | 20p12.3 |
Refseq ORF | 1152 |
Synonyms | dJ680N4.3; GPR73b; GPR73L1; GPRg2; HH3; KAL3; PKR2 |
Summary | Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded protein is similar in sequence to GPR73, another G protein-coupled receptor for prokineticins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403411 | PROKR2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403411 | Transient overexpression lysate of prokineticin receptor 2 (PROKR2) |
CNY 3,080.00 |
|
PH311216 | PROKR2 MS Standard C13 and N15-labeled recombinant protein (NP_658986) |
CNY 19,520.00 |