SNTG1 (NM_018967) Human Recombinant Protein
CAT#: TP311170
Recombinant protein of human syntrophin, gamma 1 (SNTG1), 20 µg
View other "SNTG1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211170 protein sequence
Red=Cloning site Green=Tags(s) MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTIRRQTVGGFGL SIKGGAEHNIPVVVSKISKEQRAELSGLLFIGDAILQINGINVRKCRHEEVVQVLRNAGEEVTLTVSFLK RAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIP LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPV NQQIVYMGWCEAREQDPLQDRVYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDL LDRRKQCFTVQSESGEDLYFSVELESDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF ICFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIHSFFAAKVACL DPLFLGNQATASTAASSATTSKAKYTT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 57.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061840 |
Locus ID | 54212 |
UniProt ID | Q9NSN8 |
Refseq Size | 3398 |
Cytogenetics | 8q11.21 |
Refseq ORF | 1551 |
Synonyms | G1SYN; SYN4 |
Summary | The protein encoded by this gene is a member of the syntrophin family. Syntrophins are cytoplasmic peripheral membrane proteins that typically contain 2 pleckstrin homology (PH) domains, a PDZ domain that bisects the first PH domain, and a C-terminal domain that mediates dystrophin binding. This family member plays a role in mediating gamma-enolase trafficking to the plasma membrane and in enhancing its neurotrophic activity. Mutations in this gene are associated with idiopathic scoliosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2016] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Enhanced influenza A H1N1 T cell epitope recognition and cross-reactivity to protein-O-mannosyltransferase 1 in Pandemrix-associated narcolepsy type 1
,Vuorela, A;Freitag, TL;Leskinen, K;Pessa, H;H?rk?nen, T;Stracenski, I;Kirjavainen, T;Olsen, P;Saarenp??-Heikkil?, O;Ilonen, J;Knip, M;Vaheri, A;Partinen, M;Saavalainen, P;Meri, S;Vaarala, O;,
Nature communications
,PubMed ID 33863907
[SNTG1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412854 | SNTG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412854 | Transient overexpression lysate of syntrophin, gamma 1 (SNTG1) |
CNY 3,080.00 |
|
PH311170 | SNTG1 MS Standard C13 and N15-labeled recombinant protein (NP_061840) |
CNY 19,520.00 |