C1orf77 (CHTOP) (NM_015607) Human Recombinant Protein
CAT#: TP311107
Recombinant protein of human chromosome 1 open reading frame 77 (C1orf77), 20 µg
View other "C1orf77" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC211107 protein sequence
Red=Cloning site Green=Tags(s) MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK LKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLL RGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARP VLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056422 |
Locus ID | 26097 |
UniProt ID | Q9Y3Y2 |
Refseq Size | 2172 |
Cytogenetics | 1q21.3 |
Refseq ORF | 747 |
Synonyms | C1orf77; C10orf77; FL-SRAG; FOP; pp7704; SRAG; SRAG-3; SRAG-5 |
Summary | This gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Nov 2015] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414453 | CHTOP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414453 | Transient overexpression lysate of chromosome 1 open reading frame 77 (C1orf77) |
CNY 3,080.00 |
|
PH311107 | C1orf77 MS Standard C13 and N15-labeled recombinant protein (NP_056422) |
CNY 19,520.00 |
其它C1orf77产品